Structure of PDB 7fd1 Chain A

Receptor sequence
>7fd1A (length=106) Species: 354 (Azotobacter vinelandii) [Search protein sequence]
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECP
AQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGK
LQHLER
3D structure
PDB7fd1 Oxidized and reduced Azotobacter vinelandii ferredoxin I at 1.4 A resolution: conformational change of surface residues without significant change in the [3Fe-4S]+/0 cluster.
ChainA
Resolution1.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 A F2 C20 P21 C24 F25 I34 C39 I40 D41 C42 A43 C45 F2 C20 P21 C24 F25 I34 C39 I40 D41 C42 A43 C45
BS02 F3S A C8 K12 Y13 T14 C16 L32 C49 I54 C8 K12 Y13 T14 C16 L32 C49 I54
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0009055 electron transfer activity
GO:0046872 metal ion binding
GO:0051538 3 iron, 4 sulfur cluster binding
GO:0051539 4 iron, 4 sulfur cluster binding

View graph for
Molecular Function
External links
PDB RCSB:7fd1, PDBe:7fd1, PDBj:7fd1
PDBsum7fd1
PubMed10387068
UniProtP00214|FER1_AZOVI Ferredoxin-1 (Gene Name=fdxA)

[Back to BioLiP]