Structure of PDB 7fcm Chain A

Receptor sequence

>7fcmA (length=268) Species: 1236608 (Moraxella catarrhalis BBH18)

QSMLLKGQRFVVTGIASKLSIAWAIAESLHREGAQLILTYPNDKIKKRVD
MAAEAFDAVAVIECDVGSDESIQVCFDEIAKHWGVGDDKGIDGIVHAIGF
APADQLDGDFTQATTREGSQIAHDISSYSFVALAKAGRELLAARQGSLLT
LTYEGSISVLPNYNVMGMAKASLEASVRYLASSLGGEGIRVNAISAGPIR
TLAASGIKSFRRMLDVSEKIAPLQRNVSQEEVGNAALFLLSPWASGITGE
ILFVDAGFNTVAISEKIM

3D structure

• PDB: 7fcm Crystal structure of enoyl-ACP-reductase (FabI) from Moraxella catarrhalis in complex with the cofactor NAD
• Chain: A
• Resolution: 2.22 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	A	G12 A14 S18 I19 P39 D63 V64 A95 I96 G97 L149 T150 Y151 K168 A194 G195 P196 I197 T199 A201	G14 A16 S20 I21 P41 D65 V66 A97 I98 G99 L151 T152 Y153 K170 A196 G197 P198 I199 T201 A203
BS02	TCL	A	G97 A99 L104 Y151 Y161 A201 A202	G99 A101 L106 Y153 Y163 A203 A204
BS03	CA	A	E248 I249	E250 I251

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Nov 25 03:57:12 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7fcm', asym_id = 'A', title = 'Crystal structure of enoyl-ACP-reductase (FabI) ...ella catarrhalis in complex with the cofactor NAD'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7fcm', asym_id='A', title='Crystal structure of enoyl-ACP-reductase (FabI) ...ella catarrhalis in complex with the cofactor NAD')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004318,0006633', uniprot = '', pdbid = '7fcm', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004318,0006633', uniprot='', pdbid='7fcm', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>