Structure of PDB 7fb5 Chain A

Receptor sequence

>7fb5A (length=117) Species: 10090 (Mus musculus) [Search protein sequence]

MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYL
VPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHE
EDFFLYIAYSDESVYGL

3D structure

PDB

7fb5 The crystal structure of the FAM134B-GABARAP complex provides mechanistic insights into the selective binding of FAM134 to the GABARAP subfamily.

Chain

Resolution

2.84 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	I21 R28 K48 Y49 L50 P52 L55 Q59 F62 L63 K66 R67 F104	I21 R28 K48 Y49 L50 P52 L55 Q59 F62 L63 K66 R67 F104

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0008017	microtubule binding
GO:0008429	phosphatidylethanolamine binding
GO:0031625	ubiquitin protein ligase binding
GO:0048487	beta-tubulin binding
GO:0050811	GABA receptor binding

	Biological Process
GO:0000226	microtubule cytoskeleton organization
GO:0006914	autophagy
GO:0006915	apoptotic process
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors
GO:0015031	protein transport
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0035020	regulation of Rac protein signal transduction
GO:0098696	regulation of neurotransmitter receptor localization to postsynaptic specialization membrane
GO:1902524	positive regulation of protein K48-linked ubiquitination

	Cellular Component
GO:0000139	Golgi membrane
GO:0000421	autophagosome membrane
GO:0005737	cytoplasm
GO:0005764	lysosome
GO:0005776	autophagosome
GO:0005790	smooth endoplasmic reticulum
GO:0005794	Golgi apparatus
GO:0005856	cytoskeleton
GO:0005874	microtubule
GO:0005875	microtubule associated complex
GO:0005886	plasma membrane
GO:0005930	axoneme
GO:0012505	endomembrane system
GO:0015629	actin cytoskeleton
GO:0016020	membrane
GO:0031410	cytoplasmic vesicle
GO:0097225	sperm midpiece
GO:0098982	GABA-ergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7fb5, PDBe:7fb5, PDBj:7fb5
PDBsum	7fb5
PubMed	34854256
UniProt	Q9DCD6\|GBRAP_MOUSE Gamma-aminobutyric acid receptor-associated protein (Gene Name=Gabarap)

[Back to BioLiP]