Structure of PDB 7f9h Chain A

Receptor sequence

>7f9hA (length=76) Species: 1263550 (Edwardsiella piscicida)

SQKKRSKGSAQDWHRADIVAALHKRGITLAGLSRAHGLAARTLSNAMERH
YPRAERLIAQALDMRPEDIWPQRYRN

3D structure

• PDB: 7f9h Xenogeneic nucleoid-associated EnrR thwarts H-NS silencing of bacterial virulence with unique DNA binding.
• Chain: A
• Resolution: 1.78 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	L44 A45 R47 T48 R55 Y57 P58 R59	L38 A39 R41 T42 R49 Y51 P52 R53
BS02	dna	A	R21 H29 T34 L35 A36 R40 E54	R15 H23 T28 L29 A30 R34 E48

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Nov 17 02:46:13 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7f9h', asym_id = 'A', title = 'Xenogeneic nucleoid-associated EnrR thwarts H-NS...g of bacterial virulence with unique DNA binding.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7f9h', asym_id='A', title='Xenogeneic nucleoid-associated EnrR thwarts H-NS...g of bacterial virulence with unique DNA binding.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003677', uniprot = '', pdbid = '7f9h', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677', uniprot='', pdbid='7f9h', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>