Structure of PDB 7f8n Chain A

Receptor sequence
>7f8nA (length=309) Species: 9606 (Homo sapiens) [Search protein sequence]
SDFLLKEPTEPKFKGLRLELAVDKMVTCIAVGLPLLLISLAFAQEISIGT
QISCFSPSSFSWRQAAFVDSYCWAAVQQKNSLQSGNLPLWLHKFFPYILL
LFAILLYLPPLFWRFAAAPHICSDLKFIMEELDKVYNRAIKAAKSAKYPI
VEQYLKTKKNSNNLIIKYISCRLLTLIIILLACIYLGYYFSLSSLSDEFV
CSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVINLVVYVLLAPVVVYTL
FVPFRQKTDVLKVYEILPTFLHFKSEGYNDLSLYNLFLEENISEVKSYKC
LKVLENIKS
3D structure
PDB7f8n Structures of human pannexin-1 in nanodiscs reveal gating mediated by dynamic movement of the N terminus and phospholipids.
ChainA
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 LBN A V34 P289 V292 Y293 R300 E336 E337 V22 P244 V247 Y248 R255 E289 E290
BS02 LBN A Y293 F299 Y248 F254
BS03 LBN A T39 L47 T27 L35
BS04 LBN A L275 V278 I279 V282 L230 V233 I234 V237
BS05 LBN A I41 L45 V283 L286 P289 V290 I29 L33 V238 L241 P244 V245
BS06 LBN A L115 I118 L119 L101 I104 L105
Gene Ontology
Molecular Function
GO:0002020 protease binding
GO:0003779 actin binding
GO:0005102 signaling receptor binding
GO:0005198 structural molecule activity
GO:0005243 gap junction channel activity
GO:0005253 monoatomic anion channel activity
GO:0005262 calcium channel activity
GO:0005347 ATP transmembrane transporter activity
GO:0005515 protein binding
GO:0015267 channel activity
GO:0022829 wide pore channel activity
GO:0022840 leak channel activity
GO:0044325 transmembrane transporter binding
GO:0044877 protein-containing complex binding
GO:0051015 actin filament binding
GO:0055077 gap junction hemi-channel activity
GO:0097110 scaffold protein binding
Biological Process
GO:0002931 response to ischemia
GO:0006812 monoatomic cation transport
GO:0006816 calcium ion transport
GO:0007267 cell-cell signaling
GO:0015867 ATP transport
GO:0030154 cell differentiation
GO:0032730 positive regulation of interleukin-1 alpha production
GO:0032731 positive regulation of interleukin-1 beta production
GO:0032732 positive regulation of interleukin-1 production
GO:0033198 response to ATP
GO:0048477 oogenesis
GO:0060907 positive regulation of macrophage cytokine production
GO:0070588 calcium ion transmembrane transport
GO:0098656 monoatomic anion transmembrane transport
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005886 plasma membrane
GO:0005921 gap junction
GO:0016020 membrane
GO:0032059 bleb
GO:0032991 protein-containing complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7f8n, PDBe:7f8n, PDBj:7f8n
PDBsum7f8n
PubMed35133866
UniProtQ96RD7|PANX1_HUMAN Pannexin-1 (Gene Name=PANX1)

[Back to BioLiP]