Structure of PDB 7f8l Chain A |
>7f8lA (length=104) Species: 2709072 (Bat coronavirus RaTG13) [Search protein sequence] |
QECSLQSCAQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEVGS KSPIQYIDIGNYTVSCSPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVV LDFI |
|
PDB | 7f8l Crystal Structures of Bat and Human Coronavirus ORF8 Protein Ig-Like Domain Provide Insights Into the Diversity of Immune Responses. |
Chain | A |
Resolution | 1.762 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
D34 D35 |
D17 D18 |
|
|
|