Structure of PDB 7f87 Chain A |
>7f87A (length=145) Species: 47715 (Lacticaseibacillus rhamnosus) [Search protein sequence] |
NLHPIGKIAITSVHLKLPILKGLSNDNLSAGAGTMKADQKMGEGNYALAG HYMTNQGILFSPLKNVQTGDTVAITNMKKVYTYKVTTKQIVNETQVQWID DVAGKKLITLVTCASPTEGEVDRIIVQGELQSVKKANQKNLKIFL |
|
PDB | 7f87 Crystal structure of housekeeping sortase SrtA bound with self derived tripeptide from Lactobacillus rhamnosus GG |
Chain | A |
Resolution | 1.69 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
E181 V184 |
E93 V96 |
|
|
|