Structure of PDB 7f6i Chain A

Receptor sequence

>7f6iA (length=305) Species: 9606 (Homo sapiens) [Search protein sequence]

CPQVEWLGWLNTIQPPFLWVLFVLATLENIFVLSVFCLHKSSCTVAEIYL
GNLAAADLILACGLPFWAITISNNFDWLFGETLCRVVNAIISMNLYSSIC
FLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLVIWGCTLLLSSPMLVFR
TMKEYSDEGHNVTACVISYPSLIWEVFTNMLLNVVGFLLPLSVITFCTMQ
IMQVLRNNEMQKFKEIQTERRATVLVLVVLLLFIICWLPFQISTFLDTLH
RLGILSSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEV
YQGVC

3D structure

PDB

7f6i Cryo-EM structures of human bradykinin receptor-G q proteins complexes.

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	A	L53 W113 F121 L141 R196 V212 I213 F286 T290 D293 H296 R297 D311 T314 Q315 S318 F319 Y322	L7 W67 F75 L95 R150 V166 I167 F240 T244 D247 H250 R251 D265 T268 Q269 S272 F273 Y276
BS02	CLR	A	Y177 I181	Y131 I135
BS03	CLR	A	R267 V270 V335	R221 V224 V289
BS04	CLR	A	L79 F82 C89 N98 A101 W182	L33 F36 C43 N52 A55 W136

Gene Ontology

	Molecular Function
GO:0002020	protease binding
GO:0004435	phosphatidylinositol phospholipase C activity
GO:0004930	G protein-coupled receptor activity
GO:0004947	bradykinin receptor activity
GO:0005515	protein binding
GO:0015144	carbohydrate transmembrane transporter activity
GO:0031702	type 1 angiotensin receptor binding
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0006939	smooth muscle contraction
GO:0006954	inflammatory response
GO:0007166	cell surface receptor signaling pathway
GO:0007169	cell surface receptor protein tyrosine kinase signaling pathway
GO:0007186	G protein-coupled receptor signaling pathway
GO:0007204	positive regulation of cytosolic calcium ion concentration
GO:0008015	blood circulation
GO:0008643	carbohydrate transport
GO:0009651	response to salt stress
GO:0019229	regulation of vasoconstriction
GO:0042311	vasodilation
GO:0043114	regulation of vascular permeability
GO:0050482	arachidonate secretion
GO:0055085	transmembrane transport
GO:1902219	negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress
GO:1902239	negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress by p53 class mediator
GO:1990127	intrinsic apoptotic signaling pathway in response to osmotic stress by p53 class mediator

	Cellular Component
GO:0005768	endosome
GO:0005794	Golgi apparatus
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0043231	intracellular membrane-bounded organelle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7f6i, PDBe:7f6i, PDBj:7f6i
PDBsum	7f6i
PubMed	35132089
UniProt	P30411\|BKRB2_HUMAN B2 bradykinin receptor (Gene Name=BDKRB2)

[Back to BioLiP]