Structure of PDB 7f6h Chain A

Receptor sequence
>7f6hA (length=305) Species: 9606 (Homo sapiens) [Search protein sequence]
CPQVEWLGWLNTIQPPFLWVLFVLATLENIFVLSVFCLHKSSCTVAEIYL
GNLAAADLILACGLPFWAITISNNFDWLFGETLCRVVNAIISMNLYSSIC
FLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLVIWGCTLLLSSPMLVFR
TMKEYSDEGHNVTACVISYPSLIWEVFTNMLLNVVGFLLPLSVITFCTMQ
IMQVLRNNEMQKFKEIQTERRATVLVLVVLLLFIICWLPFQISTFLDTLH
RLGILSSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEV
YQGVC
3D structure
PDB7f6h Cryo-EM structures of human bradykinin receptor-G q proteins complexes.
ChainA
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A W113 F121 L141 R196 Y201 V212 I213 L228 F286 R297 D311 T314 S318 Y322 W67 F75 L95 R150 Y155 V166 I167 L182 F240 R251 D265 T268 S272 Y276
BS02 CLR A Y177 I181 C184 Y131 I135 C138
Gene Ontology
Molecular Function
GO:0002020 protease binding
GO:0004435 phosphatidylinositol phospholipase C activity
GO:0004930 G protein-coupled receptor activity
GO:0004947 bradykinin receptor activity
GO:0005515 protein binding
GO:0015144 carbohydrate transmembrane transporter activity
GO:0031702 type 1 angiotensin receptor binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006939 smooth muscle contraction
GO:0006954 inflammatory response
GO:0007166 cell surface receptor signaling pathway
GO:0007169 cell surface receptor protein tyrosine kinase signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0008015 blood circulation
GO:0008643 carbohydrate transport
GO:0009651 response to salt stress
GO:0019229 regulation of vasoconstriction
GO:0042311 vasodilation
GO:0043114 regulation of vascular permeability
GO:0050482 arachidonate secretion
GO:0055085 transmembrane transport
GO:1902219 negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress
GO:1902239 negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress by p53 class mediator
GO:1990127 intrinsic apoptotic signaling pathway in response to osmotic stress by p53 class mediator
Cellular Component
GO:0005768 endosome
GO:0005794 Golgi apparatus
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7f6h, PDBe:7f6h, PDBj:7f6h
PDBsum7f6h
PubMed35132089
UniProtP30411|BKRB2_HUMAN B2 bradykinin receptor (Gene Name=BDKRB2)

[Back to BioLiP]