Structure of PDB 7f05 Chain A

Receptor sequence

>7f05A (length=347) Species: 9606 (Homo sapiens) [Search protein sequence]

EEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQ
FQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKG
DRTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDYIKLIG
FFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEP
FMDEPIAIPNKPYTEEELVEFVKEHQRPTLRRLRPEEMFETWEDDLNGIH
IVAFAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWE
KTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVL

3D structure

PDB

7f05 Ca2+-dependent Formation of a Non-transmembrane Channel in a Calsequestrin-2 Dimer

Chain

Resolution

2.298 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CA	A	D278 D280	D259 D261
BS02	CA	A	D280 E283 D349 D350	D261 E264 D330 D331
BS03	CA	A	E136 D140	E117 D121
BS04	CA	A	E110 D126 E262	E91 D107 E243
BS05	CA	A	E110 E124 D126 E259	E91 E105 D107 E240
BS06	CA	A	E184 E187	E165 E168
BS07	CA	A	E275 D309	E256 D290
BS08	CA	A	E218 T248 T296	E199 T229 T277
BS09	CA	A	N229 P231 E236	N210 P212 E217
BS10	CA	A	S208 E213	S189 E194
BS11	CA	A	D32 V34 E74 E78	D13 V15 E55 E59
BS12	CA	A	E262 D264	E243 D245
BS13	CA	A	D140 E143	D121 E124

Gene Ontology

	Molecular Function
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0042803	protein homodimerization activity
GO:0046872	metal ion binding
GO:0048306	calcium-dependent protein binding
GO:0140314	calcium ion sequestering activity

	Biological Process
GO:0002027	regulation of heart rate
GO:0005513	detection of calcium ion
GO:0006874	intracellular calcium ion homeostasis
GO:0006941	striated muscle contraction
GO:0010649	regulation of cell communication by electrical coupling
GO:0010880	regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
GO:0010881	regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion
GO:0043267	negative regulation of potassium ion transport
GO:0051208	sequestering of calcium ion
GO:0051258	protein polymerization
GO:0060048	cardiac muscle contraction
GO:0060306	regulation of membrane repolarization
GO:0060315	negative regulation of ryanodine-sensitive calcium-release channel activity
GO:0071313	cellular response to caffeine
GO:0086029	Purkinje myocyte to ventricular cardiac muscle cell signaling
GO:1901017	negative regulation of potassium ion transmembrane transporter activity

	Cellular Component
GO:0005737	cytoplasm
GO:0014701	junctional sarcoplasmic reticulum membrane
GO:0016529	sarcoplasmic reticulum
GO:0030018	Z disc
GO:0033017	sarcoplasmic reticulum membrane
GO:0033018	sarcoplasmic reticulum lumen
GO:0034704	calcium channel complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7f05, PDBe:7f05, PDBj:7f05
PDBsum	7f05
PubMed
UniProt	O14958\|CASQ2_HUMAN Calsequestrin-2 (Gene Name=CASQ2)

[Back to BioLiP]