Structure of PDB 7euw Chain A

Receptor sequence

>7euwA (length=132) Species: 9606 (Homo sapiens) [Search protein sequence]

MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDIL
TLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDG
QETTLVRELIDGKLILTLTHGTAVCTRTYEKE

3D structure

PDB

7euw X-ray structure of the human heart fatty acid-binding protein complexed with 4-[2-[1-(4-bromophenyl)-5-phenyl-1H-pyrazol-3-yl]phenoxy] (HA176)

Chain

Resolution

1.55 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	JEC	A	F16 Y19 V32 A33 P38 T53 S55 K58 A75 D76 L115 R126 Y128	F17 Y20 V33 A34 P39 T54 S56 K59 A76 D77 L116 R127 Y129
BS02	SO3	A	G6 T7 K130	G7 T8 K131

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0008092	cytoskeletal protein binding
GO:0008289	lipid binding
GO:0036041	long-chain fatty acid binding
GO:0070538	oleic acid binding

	Biological Process
GO:0008285	negative regulation of cell population proliferation
GO:0015909	long-chain fatty acid transport
GO:0032365	intracellular lipid transport
GO:0042632	cholesterol homeostasis
GO:0046320	regulation of fatty acid oxidation
GO:0050873	brown fat cell differentiation
GO:0055091	phospholipid homeostasis
GO:0071073	positive regulation of phospholipid biosynthetic process
GO:0140214	positive regulation of long-chain fatty acid import into cell
GO:2001245	regulation of phosphatidylcholine biosynthetic process

External links

PDB	RCSB:7euw, PDBe:7euw, PDBj:7euw
PDBsum	7euw
PubMed
UniProt	P05413\|FABPH_HUMAN Fatty acid-binding protein, heart (Gene Name=FABP3)