Structure of PDB 7etw Chain A

Receptor sequence
>7etwA (length=197) Species: 9606 (Homo sapiens) [Search protein sequence]
ISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIF
SSAWWVPPCCGTASAVIGLLYPSIDRHLGEPHKFKREWSSVMRCVAVFVG
INHASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATV
VTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYE
3D structure
PDB7etw Structural basis for sterol sensing by Scap and Insig
ChainA
Resolution4.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 AJP A Q50 A123 Y178 F196 Q33 A106 Y161 F179
BS02 AJP A N47 Q52 S69 C76 T169 Y178 Q179 F196 N30 Q35 S52 C59 T152 Y161 Q162 F179
BS03 AJP A A121 K124 L140 A104 K107 L123
BS04 AJP A N130 A138 F197 N113 A121 F180
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008142 oxysterol binding
GO:0008289 lipid binding
GO:0140311 protein sequestering activity
Biological Process
GO:0006641 triglyceride metabolic process
GO:0006695 cholesterol biosynthetic process
GO:0006991 response to sterol depletion
GO:0008203 cholesterol metabolic process
GO:0010894 negative regulation of steroid biosynthetic process
GO:0016126 sterol biosynthetic process
GO:0032869 cellular response to insulin stimulus
GO:0032933 SREBP signaling pathway
GO:0036316 SREBP-SCAP complex retention in endoplasmic reticulum
GO:0042472 inner ear morphogenesis
GO:0042474 middle ear morphogenesis
GO:0045717 negative regulation of fatty acid biosynthetic process
GO:0060021 roof of mouth development
GO:0060363 cranial suture morphogenesis
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0016020 membrane
GO:0032937 SREBP-SCAP-Insig complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7etw, PDBe:7etw, PDBj:7etw
PDBsum7etw
PubMed
UniProtQ9Y5U4|INSI2_HUMAN Insulin-induced gene 2 protein (Gene Name=INSIG2)

[Back to BioLiP]