Structure of PDB 7egv Chain A

Receptor sequence

>7egvA (length=590) Species: 5544 (Trichoderma harzianum)

DESFIGKSGGEIFHEMMLRQGVKHIFGYPGGAILPVFDAIYNSKHFDFIL
PRHEQGAGHMAEGYARASGKPGVVVVTSGPGATNVITPMQDALSDGTPMV
VFCGQVPTAAIGSDAFQEADVVGISRACTKWNVMVKSVAELPRRINEAFE
IATSGRPGPVLVDLPKDVTAGILRRAIAAKELSTQQLNASIKRAADLINM
GKKPVIYAGQGVIQSEGGPELLKELADKASIPVTTTLHGLGAFDELDEKS
LHMLGMHGAAYANMAMQQADVIIALGSRFDDRVTGVVSKFAPAARQAAAE
GRGGIIHFEIMPKNINKVVQATEAVEGDVGANMKLLIPQVKAKTMEDRKE
WFDAIKGWKKKYPLSHYQRRTGLIKPQTVMEEISNLTADRKDKTYIATGV
GQHQMWVAQHFRWRHPRSMITSGGLGTMGYGLPAAIGAKVAQPDALVIDV
DGDASFNMTLTELSTAAQFNIGVKVVVLNNEEQGMVTQWQNLFYEDRYSH
THQRNPDFMKLADAMGIQHQRVAEPDKLVDALKWLINTDGPALLEVVTDK
KVPVLPMVPAGSALHEFLVFDPEKDKQRRELMKERTKGVH

3D structure

• PDB: 7egv Harzianic Acid from Trichoderma afroharzianum Is a Natural Product Inhibitor of Acetohydroxyacid Synthase.
• Chain: A
• Resolution: 2.54 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	D551 N578 E580	D453 N480 E482
BS02	TZD	A	V498 G499 Q500 H501 G524 M526 D551 A552 S553 E580 Q581 G582 M583 V584	V400 G401 Q402 H403 G426 M428 D453 A454 S455 E482 Q483 G484 M485 V486
BS03	FAD	A	R237 G305 Q306 G307 T332 L333 H334 G372 S373 R374 D376 R378 V379 E405 I406 D424 V425 M503 G521 G522	R156 G209 Q210 G211 T236 L237 H238 G276 S277 R278 D280 R282 V283 E309 I310 D328 V329 M405 G423 G424
BS04	J3L	A	F591 Y592	F493 Y494
BS05	TZD	A	P110 E135 Q198	P29 E54 Q117

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Nov 26 22:57:59 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7egv', asym_id = 'A', title = 'Harzianic Acid from Trichoderma afroharzianum Is...l Product Inhibitor of Acetohydroxyacid Synthase.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7egv', asym_id='A', title='Harzianic Acid from Trichoderma afroharzianum Is...l Product Inhibitor of Acetohydroxyacid Synthase.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0000287,0003824,0003984,0009082,0030976,0050660', uniprot = '', pdbid = '7egv', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000287,0003824,0003984,0009082,0030976,0050660', uniprot='', pdbid='7egv', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>