Structure of PDB 7ef9 Chain A

Receptor sequence

>7ef9A (length=414) Species: 10090 (Mus musculus)

QASVSPYHLFSDVADVTAFRSNLLSWYDQEKRDLPWRNLAKEEANSDRRA
YAVWVSEVMLQQTQVATVIDYYTRWMQKWPKLQDLASASLEEVNQLWSGL
GYYSRGRRLQEGARKVVEELGGHMPRTAETLQQLLPGVGRYTAGAIASIA
FDQVTGVVDGNVLRVLCRVRAIGADPTSTLVSHHLWNLAQQLVDPARPGD
FNQAAMELGATVCTPQRPLCSHCPVQSLCRAYQRVQRGQLSEECALNTRQ
CQLCLTSSSPWDPSMGVANFPRKASRRPPREEYSATCVVEQPGAIGGPLV
LLVQRPDSGLLAGLWEFPSVTLEPSEQHQHKALLQELQRWCGPLPAIRLQ
HLGEVIHIFSHIKLTYQVYSLALDQAPASTAPPGARWLTWEEFCNAAVST
AMKKVFRMYEDHRQ

3D structure

• PDB: 7ef9 Structure of the mammalian adenine DNA glycosylase MUTYH: insights into the base excision repair pathway and cancer.
• Chain: A
• Resolution: 1.97 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E105 Y189 D207
• Catalytic site (residue number reindexed from 1): E57 Y141 D159
• Enzyme Commision number: 3.2.2.31: adenine glycosylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	Q110 Q112 G147 G149 Y150 Y151 R265 G365 L366 L367 H413 F415 S416 H417 S455 T456	Q62 Q64 G99 G101 Y102 Y103 R217 G309 L310 L311 H357 F359 S360 H361 S399 T400
BS02	dna	A	L108 Q109 Q110 Q112 V113 R156 G185 G187 Y189 T190 D207 G208 N209 R212 R332	L60 Q61 Q62 Q64 V65 R108 G137 G139 Y141 T142 D159 G160 N161 R164 R276
BS03	SF4	A	R216 C261 C268 C271 C277 Y280 V323	R168 C213 C220 C223 C229 Y232 V267
BS04	ZN	A	H56 C300	H8 C244

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0016798 hydrolase activity, acting on glycosyl bonds
• GO:0019104 DNA N-glycosylase activity
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006284 base-excision repair

External links

• PDB: RCSB:7ef9, PDBe:7ef9, PDBj:7ef9
• PDBsum: 7ef9
• PubMed: 34142156
• UniProt: Q99P21|MUTYH_MOUSE Adenine DNA glycosylase (Gene Name=Mutyh)