Structure of PDB 7ef8 Chain A

Receptor sequence

>7ef8A (length=402) Species: 10090 (Mus musculus)

SVSPYHLFSDVADVTAFRSNLLSWYDQEKRDLPWRNLAKEEANSDRRAYA
VWVSEVMLQQTQVATVIDYYTRWMQKWPKLQDLASASLEEVNQLWSGLGY
YSRGRRLQEGARKVVEELGGHMPRTAETLQQLLPGVGRYTAGAIASIAFD
QVTGVVDGNVLRVLCRVRAIGADPTSTLVSHHLWNLAQQLVDPARPGDFN
QAAMELGATVCTPQRPLCSHCPVQSLCRAYQRVQEECACQLCLTSSSPWD
PSMGVANFPRKASRRPPREEYSATCVVEQPGAIGGPLVLLVQRPDSGLLA
GLWEFPSVTLEPSEQHQHKALLQELQRWCGPLPAIRLQHLGEVIHIFSHI
KLTYQVYSLALDQAPASTAPPGARWLTWEEFCNAAVSTAMKKVFRMYEDH
RQ

3D structure

• PDB: 7ef8 Structure of the mammalian adenine DNA glycosylase MUTYH: insights into the base excision repair pathway and cancer.
• Chain: A
• Resolution: 2.45 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E105 Y189 D207
• Catalytic site (residue number reindexed from 1): E55 Y139 D157
• Enzyme Commision number: 3.2.2.31: adenine glycosylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	Q110 T111 Q112 G147 G149 Y150 Y151 G365 L366 L367 H413 F415 S416 H417 S455 T456	Q60 T61 Q62 G97 G99 Y100 Y101 G297 L298 L299 H345 F347 S348 H349 S387 T388
BS02	dna	A	L108 Q109 Q110 Q112 V113 R156 G185 G187 Y189 T190 D207 G208 N209 R212 P263 K329	L58 Q59 Q60 Q62 V63 R106 G135 G137 Y139 T140 D157 G158 N159 R162 P213 K261
BS03	SF4	A	R216 C261 C268 C271 Q274 C277 V323	R166 C211 C218 C221 Q224 C227 V255
BS04	ZN	A	H56 C307 C310	H6 C239 C242

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0016798 hydrolase activity, acting on glycosyl bonds
• GO:0019104 DNA N-glycosylase activity
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006284 base-excision repair

External links

• PDB: RCSB:7ef8, PDBe:7ef8, PDBj:7ef8
• PDBsum: 7ef8
• PubMed: 34142156
• UniProt: Q99P21|MUTYH_MOUSE Adenine DNA glycosylase (Gene Name=Mutyh)