Structure of PDB 7e98 Chain A

Receptor sequence
>7e98A (length=140) Species: 55676 (Oligobrachia mashikoi) [Search protein sequence]
VCNRLEQILVKTQWAQSYGEAENRAAFSRDLFSELFNIQGSSRALFSGVG
VDDMNSAAFTAHCLRVTGALNRLISQLDQQATINADLAHLAGQHASRNLD
ASNFAAMGQAVMSVVPTHLDCFNQHAWGECYERIASGISG
3D structure
PDB7e98 Coarse snapshots of oxygen-dissociation intermediates of a giant hemoglobin elucidated by determining the oxygen saturation in individual subunits in the crystalline state.
ChainA
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM A F46 V49 H62 R65 A69 H94 R97 L99 N103 F46 V49 H62 R65 A69 H94 R97 L99 N103
BS02 OXY A F46 H62 V66 F46 H62 V66
BS03 HEM A H89 Q93 H89 Q93
Gene Ontology
Molecular Function
GO:0005344 oxygen carrier activity
GO:0005506 iron ion binding
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0001666 response to hypoxia
GO:0015671 oxygen transport
Cellular Component
GO:0005576 extracellular region
GO:0005833 hemoglobin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7e98, PDBe:7e98, PDBj:7e98
PDBsum7e98
PubMed34804547
UniProtQ7M419|GLBA1_OLIMA Extracellular giant hemoglobin major globin subunit A1 (Gene Name=ghbA1)

[Back to BioLiP]