Structure of PDB 7dwh Chain A

Receptor sequence

>7dwhA (length=95) Species: 9606 (Homo sapiens)

TRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQA
FVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGT

3D structure

• PDB: 7dwh The identification and characterization of a selected SAM-dependent methyltransferase ribozyme that is present in natural sequences
• Chain: A
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	Y13 N16 E19 K22 L49 K50 M51 R52 Q54 F56 K80 A87 K88 T89 D90 S91 D92	Y8 N11 E14 K17 L44 K45 M46 R47 Q49 F51 K75 A82 K83 T84 D85 S86 D87

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding

External links

• PDB: RCSB:7dwh, PDBe:7dwh, PDBj:7dwh
• PDBsum: 7dwh
• UniProt: P09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)