Structure of PDB 7dfa Chain A

Receptor sequence
>7dfaA (length=363) Species: 9913 (Bos taurus) [Search protein sequence]
GTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVY
VTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERL
IKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENL
EEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLD
KEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVA
MEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASST
LLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHP
KPKEEPPHREVPE
3D structure
PDB7dfa Structural studies of phosphorylation-dependent interactions between the V2R receptor and arrestin-2.
ChainA
Resolution2.54 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A T6 R7 V8 F9 K10 K11 Y63 G72 L73 T74 F75 R103 K107 K138 R165 T2 R3 V4 F5 K6 K7 Y59 G68 L69 T70 F71 R99 K103 K134 R161
Gene Ontology
Molecular Function
GO:0000822 inositol hexakisphosphate binding
GO:0001664 G protein-coupled receptor binding
GO:0005515 protein binding
GO:0005547 phosphatidylinositol-3,4,5-trisphosphate binding
GO:0030276 clathrin binding
GO:0032050 clathrin heavy chain binding
GO:0033130 acetylcholine receptor binding
GO:0035612 AP-2 adaptor complex binding
GO:0036094 small molecule binding
GO:0060090 molecular adaptor activity
Biological Process
GO:0001934 positive regulation of protein phosphorylation
GO:0002029 desensitization of G protein-coupled receptor signaling pathway
GO:0002031 G protein-coupled receptor internalization
GO:0002092 positive regulation of receptor internalization
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0007165 signal transduction
GO:0007601 visual perception
GO:0009968 negative regulation of signal transduction
GO:0015031 protein transport
GO:0031623 receptor internalization
GO:0045746 negative regulation of Notch signaling pathway
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0072583 clathrin-dependent endocytosis
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005905 clathrin-coated pit
GO:0030132 clathrin coat of coated pit
GO:0031143 pseudopodium
GO:0031410 cytoplasmic vesicle
GO:0042995 cell projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7dfa, PDBe:7dfa, PDBj:7dfa
PDBsum7dfa
PubMed33888704
UniProtP17870|ARRB1_BOVIN Beta-arrestin-1 (Gene Name=ARRB1)

[Back to BioLiP]