Structure of PDB 7d87 Chain A

Receptor sequence

>7d87A (length=202) Species: 7955 (Danio rerio) [Search protein sequence]

HILICCVCLGDNSEDADEIIQCDNCGVTVHEGCYGVDGESDSIMSSASEN
STEPWFCDACKNGVSPSCELCPSQDGIFKETDAGRWVHVVCALYVPGVAF
GDIDKLRPVTLTEMNYSKYGAKECSLCEDTRFARTGVCISCDAGMCRSFF
HVTCAQREGLLSEAAAEEDIADPFFAYCKQHADRFDRKWKRKNYLALQSY
CK

3D structure

PDB

7d87 Molecular basis for bipartite recognition of histone H3 by the PZP domain of PHF14.

Chain

Resolution

2.11 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	A	D298 E301 I303 Q304 D306 E314 V319 E322 D324 S328 S331 N333 S334 T335 E336	D15 E18 I20 Q21 D23 E31 V36 E39 D41 S45 S48 N50 S51 T52 E53
BS02	ZN	A	C424 C429 C461 H464	C141 C146 C178 H181
BS03	ZN	A	C351 C354 H371 C374	C68 C71 H88 C91
BS04	ZN	A	C407 C410 H434 C437	C124 C127 H151 C154
BS05	ZN	A	C288 C291 H313 C316	C5 C8 H30 C33
BS06	ZN	A	C305 C308 C340 C343	C22 C25 C57 C60
BS07	CA	A	D455 F457	D172 F174
BS08	CA	A	A375 L376 V378 V381	A92 L93 V95 V98

External links

PDB	RCSB:7d87, PDBe:7d87, PDBj:7d87
PDBsum	7d87
PubMed	34365506
UniProt	A0A286Y9D1\|PHF14_DANRE PHD finger protein 14 (Gene Name=phf14)

[Back to BioLiP]