Structure of PDB 7d75 Chain A |
>7d75A (length=90) Species: 3457 (Dioscoreophyllum cumminsii) [Search protein sequence] |
GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYEDK GYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP |
|
PDB | 7d75 Domain swapped structure of Monellin Loop1-mutant |
Chain | A |
Resolution | 2.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
A |
P10 F11 |
P10 F11 |
|
|
|
|