Structure of PDB 7d6l Chain A |
>7d6lA (length=142) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539) [Search protein sequence] |
HSDILTCTHCQAKNRVGAVPAGQVPSCARCGAALPWLHDGTDATFEQDLQ TSVPVLVDFWAPWCGPCRVMGPVLEDLARDLPGKVRVVKVNVDENPRTAA RFEVRSIPTLLMFKDGEEVDQMVGVTQKAALRARVEHLNQLS |
|
PDB | 7d6l Structural and Biochemical Characterization of Thioredoxin-2 from Deinococcus radiodurans. |
Chain | A |
Resolution | 1.947 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C7 C10 C27 C30 |
C7 C10 C27 C30 |
|
|
|
|