Structure of PDB 7d20 Chain A

Receptor sequence

>7d20A (length=89) Species: 9606 (Homo sapiens) [Search protein sequence]

GWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQ
EAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRG

3D structure

PDB

7d20 Structural basis of nucleosomal histone H4 lysine 20 methylation by SET8 methyltransferase.

Chain

Resolution

3.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	G46 W47 K64 L65 P66 R69	G1 W2 K19 L20 P21 R24
BS02	dna	A	R63 R72 N85 W86 R118 V119 T120 F122	R18 R27 N40 W41 R73 V74 T75 F77

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003682	chromatin binding
GO:0005515	protein binding
GO:0030527	structural constituent of chromatin
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0000132	establishment of mitotic spindle orientation
GO:0000281	mitotic cytokinesis
GO:0034080	CENP-A containing chromatin assembly
GO:0051301	cell division
GO:0051382	kinetochore assembly
GO:0061644	protein localization to CENP-A containing chromatin
GO:0071459	protein localization to chromosome, centromeric region

	Cellular Component
GO:0000775	chromosome, centromeric region
GO:0000779	condensed chromosome, centromeric region
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005694	chromosome
GO:0005721	pericentric heterochromatin
GO:0005829	cytosol
GO:0043505	CENP-A containing nucleosome
GO:0061638	CENP-A containing chromatin

External links

PDB	RCSB:7d20, PDBe:7d20, PDBj:7d20
PDBsum	7d20
PubMed	33574035
UniProt	P49450\|CENPA_HUMAN Histone H3-like centromeric protein A (Gene Name=CENPA)