Structure of PDB 7d0q Chain A

Receptor sequence

>7d0qA (length=276) Species: 9606 (Homo sapiens)

MIKTIAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHM
AKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLY
YDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQYMRQG
YGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQ
GKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWI
AKEAKRSNSNKTMDPSCLKWTPPKGT

3D structure

• PDB: 7d0q HBO1 is a versatile histone acyltransferase critical for promoter histone acylations.
• Chain: A
• Resolution: 2.21 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C474 E508
• Catalytic site (residue number reindexed from 1): C139 E173
• Enzyme Commision number: 2.3.1.48: histone acetyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	K537 E538 I539 I541 K542 Q560 L565 Y567 H572 L573 V574 L575 K576 Q578	K202 E203 I204 I206 K207 Q225 L230 Y232 H237 L238 V239 L240 K241 Q243
BS02	ZN	A	C368 C371 H384 C388	C33 C36 H49 C53
BS03	BCO	A	F428 S473 C474 I475 L476 T477 R483 Q484 G485 G487 K488 E508 S512 L514 S518 S521 K587	F93 S138 C139 I140 L141 T142 R148 Q149 G150 G152 K153 E173 S177 L179 S183 S186 K252

Gene Ontology

Molecular Function

• GO:0004402 histone acetyltransferase activity

Biological Process

• GO:0006355 regulation of DNA-templated transcription

External links

• PDB: RCSB:7d0q, PDBe:7d0q, PDBj:7d0q
• PDBsum: 7d0q
• PubMed: 34259319
• UniProt: O95251|KAT7_HUMAN Histone acetyltransferase KAT7 (Gene Name=KAT7)