Structure of PDB 7cvo Chain A

Receptor sequence

>7cvoA (length=130) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]

HQLPLARIKKIMKADEDVRMISAEAPILFAKACELFILELTIRSWLHAEE
NKRRTLQKNDIAAAITRTDIFDFLVDIVPRVTQLSPMDREARVLRYREKR
KTRKFEKTIRYASRKAYAEIRPRVNGRFAK

3D structure

PDB

7cvo Structural insights into the multivalent binding of the Arabidopsis FLOWERING LOCUS T promoter by the CO-NF-Y master transcription factor complex.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	K85 M96 I97 A99 K324 I326 R327 Y328 R331 K332 E336 R340 N342 G343 F345	K9 M20 I21 A23 K107 I109 R110 Y111 R114 K115 E119 R123 N125 G126 F128
BS02	dna	A	P80 L81 A82 R83 M96 Y328 S330 R331 Y334 R338 R344 F345 K347	P4 L5 A6 R7 M20 Y111 S113 R114 Y117 R121 R127 F128 K130

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

View graph for
Molecular Function

External links

PDB	RCSB:7cvo, PDBe:7cvo, PDBj:7cvo
PDBsum	7cvo
PubMed	33693873
UniProt	Q39057\|CONS_ARATH Zinc finger protein CONSTANS (Gene Name=CO); Q9FMV5

[Back to BioLiP]