Structure of PDB 7coc Chain A

Receptor sequence

>7cocA (length=327) Species: 9606 (Homo sapiens)

PAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKA
LPSPVTTLSQLQGLPHFGEHSSRVVQELLEHGVCEEVERVRRSERYQTMK
LFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDLST
PVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHP
KEGQEAGLLPRVMCRLQDQGLILYHQHDAFERSFCIFRLPQPGSWKAVRV
DLVVAPVSQFPFALLGWTGSALFARELRRFSRKEKGLWLNSHGLFDPEQK
TFFQAASEEDIFRHLGLEYLPPEQRNA

3D structure

• PDB: 7coc Mechanism of genome instability mediated by human DNA polymerase mu misincorporation.
• Chain: A
• Resolution: 1.9 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	L177 Q364 F385 E386 R387 R442 R445 K450 N457 H459	L39 Q226 F230 E231 R232 R275 R278 K283 N290 H292
BS02	dna	A	G245 V246 G247 T250 H329 F389 R416	G107 V108 G109 T112 H191 F234 R249
BS03	dna	A	G174 R175 T178 F179 H204 G206 H208 S209	G36 R37 T40 F41 H66 G68 H70 S71
BS04	XG4	A	G319 G320 R323 K325 G328 H329 D330 D332 G433 W434 T435 G436 A438 R445	G181 G182 R185 K187 G190 H191 D192 D194 G266 W267 T268 G269 A271 R278
BS05	MG	A	D330 D332 D418	D192 D194 D251
BS06	MG	A	D330 D332	D192 D194

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0005515 protein binding
• GO:0016779 nucleotidyltransferase activity
• GO:0034061 DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006281 DNA repair
• GO:0006303 double-strand break repair via nonhomologous end joining
• GO:0006310 DNA recombination
• GO:0071897 DNA biosynthetic process

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm

External links

• PDB: RCSB:7coc, PDBe:7coc, PDBj:7coc
• PDBsum: 7coc
• PubMed: 34145298
• UniProt: Q9NP87|DPOLM_HUMAN DNA-directed DNA/RNA polymerase mu (Gene Name=POLM)