Structure of PDB 7cob Chain A

Receptor sequence

>7cobA (length=329) Species: 9606 (Homo sapiens)

MPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLK
ALPSPVTTLSQLQGLPHFGEHSSRVVQELLEHGVCEEVERVRRSERYQTM
KLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDLS
TPVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITH
PKEGQEAGLLPRVMCRLQDQGLILYHQHQDAFERSFCIFRLPQPGSWKAV
RVDLVVAPVSQFPFALLGWTGSKLFARELRRFSRKEKGLWLNSHGLFDPE
QKTFFQAASEEDIFRHLGLEYLPPEQRNA

3D structure

• PDB: 7cob Mechanism of genome instability mediated by human DNA polymerase mu misincorporation.
• Chain: A
• Resolution: 1.797 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	F385 E386 R387 R442 R445 K450	F232 E233 R234 R277 R280 K285
BS02	dna	A	G245 V246 G247 K249 T250 H329 F389 R416	G108 V109 G110 K112 T113 H192 F236 R251
BS03	dna	A	G174 R175 T178 F179 H204 G206 H208 S209	G37 R38 T41 F42 H67 G69 H71 S72
BS04	XG4	A	G319 G320 R323 K325 G328 H329 D330 D332 G433 W434 G436 K438	G182 G183 R186 K188 G191 H192 D193 D195 G268 W269 G271 K273
BS05	MG	A	D330 D332	D193 D195
BS06	MG	A	D330 D332 D418	D193 D195 D253

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0005515 protein binding
• GO:0016779 nucleotidyltransferase activity
• GO:0034061 DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006281 DNA repair
• GO:0006303 double-strand break repair via nonhomologous end joining
• GO:0006310 DNA recombination
• GO:0071897 DNA biosynthetic process

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm

External links

• PDB: RCSB:7cob, PDBe:7cob, PDBj:7cob
• PDBsum: 7cob
• PubMed: 34145298
• UniProt: Q9NP87|DPOLM_HUMAN DNA-directed DNA/RNA polymerase mu (Gene Name=POLM)