Structure of PDB 7co8 Chain A

Receptor sequence

>7co8A (length=331) Species: 9606 (Homo sapiens)

PAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKA
LPSPVTTLSQLQGLPHFGEHSSRVVQELLEHGVCEEVERVRRSERYQTMK
LFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDLST
PVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHP
KEGQEAGLLPRVMCRLQDQGLILYHQHQHSMDAFERSFCIFRLPQPGSWK
AVRVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRKEKGLWLNSHGLFD
PEQKTFFQAASEEDIFRHLGLEYLPPEQRNA

3D structure

• PDB: 7co8 Mechanism of genome instability mediated by human DNA polymerase mu misincorporation.
• Chain: A
• Resolution: 1.697 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	L177 Q366 H367 A384 Q441 R442 R445 R449 K450 N457	L39 Q228 H229 A233 Q278 R279 R282 R286 K287 N294
BS02	dna	A	G245 V246 G247 T250 Q275 Q366 R387 F389 R416 D418 W434	G107 V108 G109 T112 Q137 Q228 R236 F238 R253 D255 W271
BS03	dna	A	G174 R175 T178 F179 H204 G206 H208 S209	G36 R37 T40 F41 H66 G68 H70 S71
BS04	XG4	A	G319 G320 R323 G328 H329 D330 D332 G436 K438 Q441	G181 G182 R185 G190 H191 D192 D194 G273 K275 Q278
BS05	MG	A	D330 D332 D418	D192 D194 D255
BS06	MG	A	D330 D332	D192 D194

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0005515 protein binding
• GO:0016779 nucleotidyltransferase activity
• GO:0034061 DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006281 DNA repair
• GO:0006303 double-strand break repair via nonhomologous end joining
• GO:0006310 DNA recombination
• GO:0071897 DNA biosynthetic process

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm

External links

• PDB: RCSB:7co8, PDBe:7co8, PDBj:7co8
• PDBsum: 7co8
• PubMed: 34145298
• UniProt: Q9NP87|DPOLM_HUMAN DNA-directed DNA/RNA polymerase mu (Gene Name=POLM)