Structure of PDB 7co6 Chain A

Receptor sequence

>7co6A (length=332) Species: 9606 (Homo sapiens)

MPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLK
ALPSPVTTLSQLQGLPHFGEHSSRVVQELLEHGVCEEVERVRRSERYQTM
KLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDLS
TPVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITH
PKEGQEAGLLPRVMCRLQDQGLILYHQHQHSMDAFERSFCIFRLPQPGSW
KAVRVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRKEKGLWLNSHGLF
DPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA

3D structure

• PDB: 7co6 Mechanism of genome instability mediated by human DNA polymerase mu misincorporation.
• Chain: A
• Resolution: 1.9 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	L177 F385 E386 R387 K438 Q441 R442 R445 R449 K450 L456 N457 H459	L40 F235 E236 R237 K276 Q279 R280 R283 R287 K288 L294 N295 H297
BS02	dna	A	G245 G247 K249 T250 F389 R416 W434	G108 G110 K112 T113 F239 R254 W272
BS03	dna	A	G174 R175 T178 F179 H204 G206 H208 S209	G37 R38 T41 F42 H67 G69 H71 S72

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0005515 protein binding
• GO:0016779 nucleotidyltransferase activity
• GO:0034061 DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006281 DNA repair
• GO:0006303 double-strand break repair via nonhomologous end joining
• GO:0006310 DNA recombination
• GO:0071897 DNA biosynthetic process

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm

External links

• PDB: RCSB:7co6, PDBe:7co6, PDBj:7co6
• PDBsum: 7co6
• PubMed: 34145298
• UniProt: Q9NP87|DPOLM_HUMAN DNA-directed DNA/RNA polymerase mu (Gene Name=POLM)