Structure of PDB 7cmr Chain A

Receptor sequence
>7cmrA (length=263) Species: 9606 (Homo sapiens) [Search protein sequence]
KYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFH
LGQCQWRQPPGKEIYRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTL
YFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRR
GYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDL
SIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPKLVEEHLKKKP
PITVDSVCLKWAP
3D structure
PDB7cmr The Crystal Structure of human MYST1 from Biortus.
ChainA
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.3.1.-
2.3.1.48: histone acetyltransferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A C210 C213 H226 C230 C34 C37 H50 C54
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
GO:0003712 transcription coregulator activity
GO:0003713 transcription coactivator activity
GO:0004402 histone acetyltransferase activity
GO:0005515 protein binding
GO:0010485 histone H4 acetyltransferase activity
GO:0016407 acetyltransferase activity
GO:0016746 acyltransferase activity
GO:0019899 enzyme binding
GO:0043995 histone H4K5 acetyltransferase activity
GO:0043996 histone H4K8 acetyltransferase activity
GO:0046872 metal ion binding
GO:0046972 histone H4K16 acetyltransferase activity
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
GO:0061733 peptide-lysine-N-acetyltransferase activity
GO:0061920 protein propionyltransferase activity
GO:1990841 promoter-specific chromatin binding
Biological Process
GO:0006325 chromatin organization
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0009048 dosage compensation by inactivation of X chromosome
GO:0010506 regulation of autophagy
GO:0010719 negative regulation of epithelial to mesenchymal transition
GO:0022008 neurogenesis
GO:0030099 myeloid cell differentiation
GO:0032480 negative regulation of type I interferon production
GO:0035166 post-embryonic hemopoiesis
GO:0045815 transcription initiation-coupled chromatin remodeling
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:0048477 oogenesis
GO:0050684 regulation of mRNA processing
GO:0060261 positive regulation of transcription initiation by RNA polymerase II
GO:1902726 positive regulation of skeletal muscle satellite cell differentiation
GO:1903108 regulation of mitochondrial transcription
Cellular Component
GO:0000123 histone acetyltransferase complex
GO:0000776 kinetochore
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005739 mitochondrion
GO:0016363 nuclear matrix
GO:0035267 NuA4 histone acetyltransferase complex
GO:0044545 NSL complex
GO:0071339 MLL1 complex
GO:0072487 MSL complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7cmr, PDBe:7cmr, PDBj:7cmr
PDBsum7cmr
PubMed
UniProtQ9H7Z6|KAT8_HUMAN Histone acetyltransferase KAT8 (Gene Name=KAT8)

[Back to BioLiP]