Structure of PDB 7cdb Chain A

Receptor sequence
>7cdbA (length=122) Species: 10090 (Mus musculus) [Search protein sequence]
PGSEFMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLD
KRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLY
EDNHEEDYFLYVAYSDESVYGK
3D structure
PDB7cdb Structural basis of GABARAP-mediated GABA A receptor trafficking and functions on GABAergic synaptic transmission.
ChainA
Resolution1.949 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A Y25 R28 L50 Y30 R33 L55
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005543 phospholipid binding
GO:0008092 cytoskeletal protein binding
GO:0030957 Tat protein binding
GO:0031625 ubiquitin protein ligase binding
GO:0043495 protein-membrane adaptor activity
Biological Process
GO:0006914 autophagy
GO:0061723 glycophagy
GO:0061753 substrate localization to autophagosome
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005776 autophagosome
GO:0005783 endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0016020 membrane
GO:0030659 cytoplasmic vesicle membrane
GO:0031410 cytoplasmic vesicle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7cdb, PDBe:7cdb, PDBj:7cdb
PDBsum7cdb
PubMed33436612
UniProtQ8R3R8|GBRL1_MOUSE Gamma-aminobutyric acid receptor-associated protein-like 1 (Gene Name=Gabarapl1)

[Back to BioLiP]