Structure of PDB 7ccy Chain A

Receptor sequence

>7ccyA (length=319) Species: 9606 (Homo sapiens)

RVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKELEHAL
EKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLE
TLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSA
IILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLV
GVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSL
DGSDSIQETMQATIHVPAQHEDGPEDDPQLVGITARNIPRGPQLAAQNLG
ISLANLLLSKGAKNILDVA

3D structure

• PDB: 7ccy Crystal structures of hydroxymethylbilane synthase complexed with a substrate analog: a single substrate-binding site for four consecutive condensation steps.
• Chain: A
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K98 D99 R149 R150 R167 R173 C261
• Catalytic site (residue number reindexed from 1): K63 D64 R114 R115 R132 R138 C226
• Enzyme Commision number: 2.5.1.61: hydroxymethylbilane synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DPM	A	S96 K98 D99 S146 S147 R149 R150 R173 A189 C261	S61 K63 D64 S111 S112 R114 R115 R138 A154 C226

Gene Ontology

Molecular Function

• GO:0004418 hydroxymethylbilane synthase activity
• GO:0005515 protein binding
• GO:0016740 transferase activity

Biological Process

• GO:0006779 porphyrin-containing compound biosynthetic process
• GO:0006782 protoporphyrinogen IX biosynthetic process
• GO:0006783 heme biosynthetic process
• GO:0006784 heme A biosynthetic process
• GO:0006785 heme B biosynthetic process
• GO:0018160 peptidyl-pyrromethane cofactor linkage
• GO:0033014 tetrapyrrole biosynthetic process
• GO:0048034 heme O biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:7ccy, PDBe:7ccy, PDBj:7ccy
• PDBsum: 7ccy
• PubMed: 33600566
• UniProt: P08397|HEM3_HUMAN Porphobilinogen deaminase (Gene Name=HMBS)