Structure of PDB 7ccq Chain A

Receptor sequence
>7ccqA (length=95) Species: 9606 (Homo sapiens) [Search protein sequence]
RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV
MALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB7ccq Structural basis for nucleosome-mediated inhibition of cGAS activity.
ChainA
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A Y41 R42 P43 T45 R63 R72 R83 F84 Q85 R116 V117 T118 M120 Y2 R3 P4 T6 R24 R33 R44 F45 Q46 R77 V78 T79 M81
BS02 dna A R40 Y41 P43 G44 V46 R49 R63 K64 L65 P66 R83 R1 Y2 P4 G5 V7 R10 R24 K25 L26 P27 R44
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7ccq, PDBe:7ccq, PDBj:7ccq
PDBsum7ccq
PubMed33051594
UniProtP68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]