Structure of PDB 7c9o Chain A

Receptor sequence
>7c9oA (length=45) Species: 39947 (Oryza sativa Japonica Group) [Search protein sequence]
SMDREARVLRYREKKKARKFEKTIRYETRKAYAEARPRIKGRFAK
3D structure
PDB7c9o Structural Insight into DNA Recognition by CCT/NF-YB/YC Complexes in Plant Photoperiodic Flowering.
ChainA
Resolution2.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A Y366 R370 R376 F377 A378 K379 Y32 R36 R42 F43 A44 K45
BS02 dna A K356 R359 Y360 R363 K364 A367 R372 K374 G375 F377 K22 R25 Y26 R29 K30 A33 R38 K40 G41 F43
Gene Ontology
Biological Process
GO:0009909 regulation of flower development

View graph for
Biological Process
External links
PDB RCSB:7c9o, PDBe:7c9o, PDBj:7c9o
PDBsum7c9o
PubMed32843433
UniProtQ9FDX8|HD1_ORYSJ Zinc finger protein HD1 (Gene Name=HD1)

[Back to BioLiP]