Structure of PDB 7c99 Chain A

Receptor sequence
>7c99A (length=309) Species: 9606 (Homo sapiens) [Search protein sequence]
QDIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVD
KIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAI
TEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLR
DIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLI
IDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMT
ADPGAPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATF
AITAGGIGD
3D structure
PDB7c99 Identification of fidelity-governing factors in human recombinases DMC1 and RAD51 from cryo-EM structures.
ChainA
Resolution3.36 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 dna A R242 T271 A272 P274 H291 R221 T250 A251 P253 H263
BS02 dna A R236 G275 R215 G254
BS03 CA A T133 E162 T112 E141
BS04 ANP A F128 G131 K132 T133 Q134 I330 F107 G110 K111 T112 Q113 I302
Gene Ontology
Molecular Function
GO:0000150 DNA strand exchange activity
GO:0000166 nucleotide binding
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0003697 single-stranded DNA binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008094 ATP-dependent activity, acting on DNA
GO:0016887 ATP hydrolysis activity
GO:0042802 identical protein binding
GO:0140664 ATP-dependent DNA damage sensor activity
Biological Process
GO:0000724 double-strand break repair via homologous recombination
GO:0000730 DNA recombinase assembly
GO:0001541 ovarian follicle development
GO:0001556 oocyte maturation
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0006312 mitotic recombination
GO:0007129 homologous chromosome pairing at meiosis
GO:0007131 reciprocal meiotic recombination
GO:0007141 male meiosis I
GO:0007276 gamete generation
GO:0007283 spermatogenesis
GO:0007286 spermatid development
GO:0007292 female gamete generation
GO:0042148 DNA strand invasion
GO:0048477 oogenesis
GO:0051321 meiotic cell cycle
GO:0070192 chromosome organization involved in meiotic cell cycle
GO:1990918 double-strand break repair involved in meiotic recombination
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000794 condensed nuclear chromosome
GO:0000800 lateral element
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0035861 site of double-strand break

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7c99, PDBe:7c99, PDBj:7c99
PDBsum7c99
PubMed33446654
UniProtQ14565|DMC1_HUMAN Meiotic recombination protein DMC1/LIM15 homolog (Gene Name=DMC1)

[Back to BioLiP]