Structure of PDB 7c7e Chain A |
>7c7eA (length=142) Species: 585057 (Escherichia coli IAI39) [Search protein sequence] |
TDVLQWVLENDYDPRLISAMSEVRNLVEPAIARWAAERATSSDLAQIESA LNEMIANNQDREAFNEADIRYHEAVLQSVHNPVLQQLSIAISSLQRAVFE GDEANMPQTLQEHKALFDAIRHQDGDAAEQAALTMIASSTRR |
|
PDB | 7c7e Structural and Functional Analyses of the Transcription Repressor DgoR From Escherichia coli Reveal a Divalent Metal-Containing D-Galactonate Binding Pocket. |
Chain | A |
Resolution | 2.047 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
D146 H150 H195 |
D68 H72 H113 |
|
|
|
|