Structure of PDB 7c1m Chain A

Receptor sequence

>7c1mA (length=67) Species: 555311 (Saccharolobus solfataricus 98/2)

GSHMATVKFKYKGEEKQVDISKILSVGRYGKLIHFLYDLGGGKAGMGMVS
EKDAPKELLQMLEKQKK

3D structure

• PDB: 7c1m Genetically encoded live-cell sensor for tyrosinated microtubules.
• Chain: A
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	Y11 K12 K16 Y29 G30 L32 H34 Y37 L39 K43 G45 M46 G47 M48	Y11 K12 K16 Y29 G30 L32 H34 Y37 L39 K43 G45 M46 G47 M48

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 22 18:40:29 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7c1m', asym_id = 'A', title = 'Genetically encoded live-cell sensor for tyrosinated microtubules.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7c1m', asym_id='A', title='Genetically encoded live-cell sensor for tyrosinated microtubules.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003677,0004521', uniprot = '', pdbid = '7c1m', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0004521', uniprot='', pdbid='7c1m', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>