Structure of PDB 7c1j Chain A |
>7c1jA (length=122) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] |
AGQEILLVEDNPVNQTVIEAMLRSLGYRVTLVADGIQAVRSAERQRYDAI LMDCRLPVLDGYSATREIRAQENGRRVPIIALTANALQGDRENCLQAGMN DYLAKPFKRAELQRILQRWIGS |
|
PDB | 7c1j Structural insights into the histidine-containing phospho-transfer protein and receiver domain of sensor histidine kinase suggest a complex model in the two-component regulatory system in Pseudomonas aeruginosa |
Chain | A |
Resolution | 1.35 Å |
3D structure |
|
|
Enzyme Commision number |
2.7.13.3: histidine kinase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
A |
D522 D565 R567 |
D10 D53 R55 |
|
|
|
|