Structure of PDB 7c0j Chain A

Receptor sequence

>7c0jA (length=59) Species: 9031,9606

PTYSEMIAAAIRAGSSRQSIQAYIKSHYHNKKEINRVLYSLLAAGVLKQT
GVPGSWALA

3D structure

• PDB: 7c0j Dual conformational recognition by Z-DNA binding protein is important for the B-Z transition process.
• Chain: A
• Resolution: 2.75 Å

Enzymatic activity

• Enzyme Commision number:
  3.5.4.37: double-stranded RNA adenine deaminase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	K1169 K1170 N1173 R1174 Y1177 V88	K31 K32 N35 R36 Y39 V52

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0030527 structural constituent of chromatin

Biological Process

• GO:0006334 nucleosome assembly

Cellular Component

• GO:0000786 nucleosome

External links

• PDB: RCSB:7c0j, PDBe:7c0j, PDBj:7c0j
• PDBsum: 7c0j
• PubMed: 33245772
• UniProt: P02259|H5_CHICK Histone H5;
  P55265|DSRAD_HUMAN Double-stranded RNA-specific adenosine deaminase (Gene Name=ADAR)