Structure of PDB 7c0g Chain A |
>7c0gA (length=72) Species: 1223260 (Pseudomonas phage JBD30) [Search protein sequence] |
KTPDASNHDPDPRYLRGLLKKAGISQRRAAELLGLSDRVMRYYLSEDIKE GYRPAPYTVQFALECLANDPPS |
|
PDB | 7c0g Aca1 in complex with 14bp palindromic DNA target |
Chain | A |
Resolution | 2.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
A |
R44 Y48 |
R38 Y42 |
|
|
|
|