Structure of PDB 7c06 Chain A

Receptor sequence

>7c06A (length=193) Species: 284812 (Schizosaccharomyces pombe 972h-)

ASHLASIYGTEQDKVNCSFYYKIGACRHGERCSRKHVKPNFSQTILCPNM
YKNPIHEPNGKKFTQRELAEQFDAFYEDMFCEFSKYGEVEQLVVCDNVGD
HLVGNVYVRFKYEESAQNAIDDLNSRWYSQRPVYAELSPVTDFREACCRQ
HETSECQRGGLCNFMHAKKPSPQLLRDLVLAQRKYLALNAAEE

3D structure

• PDB: 7c06 Elucidation of the aberrant 3' splice site selection by cancer-associated mutations on the U2AF1.
• Chain: A
• Resolution: 3.02 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	T11 E12 F20 K23 R28 H29 C33 S34 R35 E146 C148 C149 R150 Q151 R159 N164 F165	T10 E11 F19 K22 R27 H28 C32 S33 R34 E145 C147 C148 R149 Q150 R158 N163 F164
BS02	rna	A	P173 Q174	P172 Q173
BS03	ZN	A	C18 C27 C33 H37	C17 C26 C32 H36
BS04	ZN	A	C149 C157 C163 H167	C148 C156 C162 H166

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0030628 pre-mRNA 3'-splice site binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000389 mRNA 3'-splice site recognition
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0045292 mRNA cis splicing, via spliceosome

Cellular Component

• GO:0000243 commitment complex
• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005829 cytosol
• GO:0071004 U2-type prespliceosome
• GO:0089701 U2AF complex

External links

• PDB: RCSB:7c06, PDBe:7c06, PDBj:7c06
• PDBsum: 7c06
• PubMed: 32958768
• UniProt: Q09176|U2AF1_SCHPO Splicing factor U2AF 23 kDa subunit (Gene Name=SPAP8A3.06)