Structure of PDB 7bum Chain A

Receptor sequence
>7bumA (length=361) Species: 10090 (Mus musculus) [Search protein sequence]
PDKLKKVLDKLRLKRKDISEAAETVNKVVERLLRRMQKRESEFKGVEQLN
TGSYYEHVKISAPNEFDVMFKLEVPRIELQEYYETGAFYLVKFKRIPRGN
PLSHFLEGEVLSATKMLSKFRKIIKEEVKEIKDIDVSVEKEKPGSPAVTL
LIRNPEEISVDIILALESKGSWPISTKEGLPIQGWLGTKVRTNLRREPFY
LVPKNAKDGNSFQGETWRLSFSHTEKYILNNHGIEKTCCESSGAKCCRKE
CLKLMKYLLEQLKKEFQELDAFCSYHVKTAIFHMWTQDPQDSQWDPRNLS
SCFDKLLAFFLECLRTEKLDHYFIPKFNLFSQELIDRKSKEFLSKKIEYE
RNNGFPIFDKL
3D structure
PDB7bum Mn2+Directly Activates cGAS and Structural Analysis Suggests Mn2+Induces a Noncanonical Catalytic Synthesis of 2'3'-cGAMP.
ChainA
Resolution3.047 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.7.86: cyclic GMP-AMP synthase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A H378 C385 C392 H232 C239 C246
BS02 A A R364 Y421 R218 Y275
BS03 5GP A D213 S291 I309 K350 R364 D67 S145 I163 K204 R218
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0003690 double-stranded DNA binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0005525 GTP binding
GO:0005546 phosphatidylinositol-4,5-bisphosphate binding
GO:0008289 lipid binding
GO:0016779 nucleotidyltransferase activity
GO:0031491 nucleosome binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0061501 2',3'-cyclic GMP-AMP synthase activity
GO:0140693 molecular condensate scaffold activity
GO:0160004 poly-ADP-D-ribose modification-dependent protein binding
Biological Process
GO:0002218 activation of innate immune response
GO:0002221 pattern recognition receptor signaling pathway
GO:0002230 positive regulation of defense response to virus by host
GO:0002637 regulation of immunoglobulin production
GO:0002753 cytoplasmic pattern recognition receptor signaling pathway
GO:0006281 DNA repair
GO:0006974 DNA damage response
GO:0008340 determination of adult lifespan
GO:0019933 cAMP-mediated signaling
GO:0019934 cGMP-mediated signaling
GO:0032479 regulation of type I interferon production
GO:0032481 positive regulation of type I interferon production
GO:0038001 paracrine signaling
GO:0045087 innate immune response
GO:0045738 negative regulation of DNA repair
GO:0050776 regulation of immune response
GO:0050863 regulation of T cell activation
GO:0051607 defense response to virus
GO:0071360 cellular response to exogenous dsRNA
GO:0140896 cGAS/STING signaling pathway
GO:0160049 negative regulation of cGAS/STING signaling pathway
GO:2000042 negative regulation of double-strand break repair via homologous recombination
GO:2000774 positive regulation of cellular senescence
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0016604 nuclear body
GO:0035861 site of double-strand break

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7bum, PDBe:7bum, PDBj:7bum
PDBsum7bum
PubMed32814054
UniProtQ8C6L5|CGAS_MOUSE Cyclic GMP-AMP synthase (Gene Name=Cgas)

[Back to BioLiP]