Structure of PDB 7br0 Chain A

Receptor sequence

>7br0A (length=318) Species: 332952 (Aspergillus flavus NRRL3357)

SSIPLYDCLIIGGGIAGLSSALSLVRTLHTAVVFDEGIHRNDQAPHLATV
PTWDSQDPKRFRDAAKLNILSKYSTVEFANVKLEKVNQLTDGPYKGYFCV
WDTKQRQWLGRKVILAMGVEDLLPTIDGFAECWTKGIFHCLVHRGYEERG
SASGGVLAIDGDATFFAARHLAFQARNLTDHVVIYTHGNDELAQEVESQL
GPCGFRAESRRIEKLVQHPERAQMEVHFEDGQSETVGFIVHRPRTSIRGP
FAEQLGVEMTPEGHIKTQFPFNETTVSGVFVAGDAGSQFKIGTQAVVMGA
FAAGGVQMQVNAEKWSQP

3D structure

• PDB: 7br0 Specialized Flavoprotein Promotes Sulfur Migration and Spiroaminal Formation in Aspirochlorine Biosynthesis.
• Chain: A
• Resolution: 2.003 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	G16 G17 G18 A20 D39 E40 I42 H43 R44 N45 L51 A52 L87 A120 M121 H143 H147 R252 F255 G287 D288 K294 I295 G296	G12 G13 G14 A16 D35 E36 I38 H39 R40 N41 L47 A48 L83 A116 M117 H139 H143 R248 F251 G283 D284 K290 I291 G292

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Nov 26 23:10:39 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7br0', asym_id = 'A', title = 'Specialized Flavoprotein Promotes Sulfur Migrati...oaminal Formation in Aspirochlorine Biosynthesis.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7br0', asym_id='A', title='Specialized Flavoprotein Promotes Sulfur Migrati...oaminal Formation in Aspirochlorine Biosynthesis.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016491', uniprot = '', pdbid = '7br0', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016491', uniprot='', pdbid='7br0', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>