Structure of PDB 7bph Chain A

Receptor sequence

>7bphA (length=360) Species: 9606 (Homo sapiens) [Search protein sequence]

KAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVN
GFNKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSV
MNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDV
IKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKW
IQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRT
ISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRV
TRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQ
RMHLRQYELL

3D structure

PDB

7bph State-selective modulation of heterotrimeric G alpha s signaling with macrocyclic peptides.

Chain

Resolution

1.57 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	A	R228 R231 R232 N271 L272 K274 S275 N278 N279 R280	R194 R197 R198 N237 L238 K240 S241 N244 N245 R246
BS02	GNP	A	E50 S51 G52 K53 S54 T55 D173 R199 T204 G226 N292 K293 D295 L296 C365 A366 V367	E34 S35 G36 K37 S38 T39 D139 R165 T170 G192 N258 K259 D261 L262 C331 A332 V333
BS03	MG	A	S54 T204	S38 T170

Gene Ontology

	Molecular Function
GO:0003924	GTPase activity
GO:0003925	G protein activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0010856	adenylate cyclase activator activity
GO:0016787	hydrolase activity
GO:0019001	guanyl nucleotide binding
GO:0031683	G-protein beta/gamma-subunit complex binding
GO:0031748	D1 dopamine receptor binding
GO:0046872	metal ion binding

	Biological Process
GO:0002862	negative regulation of inflammatory response to antigenic stimulus
GO:0003091	renal water homeostasis
GO:0007165	signal transduction
GO:0007186	G protein-coupled receptor signaling pathway
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007190	activation of adenylate cyclase activity
GO:0007191	adenylate cyclase-activating dopamine receptor signaling pathway
GO:0007608	sensory perception of smell
GO:0046907	intracellular transport
GO:0048589	developmental growth
GO:0050796	regulation of insulin secretion
GO:0050890	cognition
GO:0060348	bone development
GO:0060789	hair follicle placode formation
GO:0070527	platelet aggregation
GO:0071377	cellular response to glucagon stimulus
GO:0071380	cellular response to prostaglandin E stimulus
GO:0071870	cellular response to catecholamine stimulus
GO:0071880	adenylate cyclase-activating adrenergic receptor signaling pathway
GO:0120162	positive regulation of cold-induced thermogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005834	heterotrimeric G-protein complex
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0032588	trans-Golgi network membrane
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7bph, PDBe:7bph, PDBj:7bph
PDBsum	7bph
PubMed	36170854
UniProt	P63092\|GNAS2_HUMAN Guanine nucleotide-binding protein G(s) subunit alpha isoforms short (Gene Name=GNAS)

[Back to BioLiP]