Structure of PDB 7bmu Chain A |
>7bmuA (length=115) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] |
NLYFQGAMSIPRSQTTYKKKEGILTLTEDRKFLIWTPLPATGPPTVSLAL DNITNLQQTPPGSAKVILKFTERPRPNAEPGAPPPQYMFQFTHPTDARAE ANAIRDLLSQLLAAA |
|
PDB | 7bmu Cesium based phasing of macromolecules: a general easy to use approach for solving the phase problem. |
Chain | A |
Resolution | 1.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CL |
A |
P54 R91 |
P61 R98 |
|
BS02 |
CS |
A |
R5 E93 |
R12 E100 |
|
|
|
|