Structure of PDB 7bb7 Chain A

Receptor sequence
>7bb7A (length=268) Species: 9606 (Homo sapiens) [Search protein sequence]
TRDPLLARAELALLSIVFVAVALSNGLVLAALARRGRRGHWAPIHVFIGH
LCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQMVGMYASSYMI
LAMTLDRHRAICRPVLVAWAFSLLLSLPQLFIFAQRNVEGGSGVTDCWAC
FAEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHASSAAVAKTVRM
TLVIVVVYVLCWAPFFLVQLWAAWDPEAPLEGAPFVLLMLLASLNSCTNP
WIYASFSSSVSSELRSLL
3D structure
PDB7bb7 Cryo-electron microscopy structure of the antidiuretic hormone arginine-vasopressin V2 receptor signaling complex.
ChainA
Resolution4.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A R32 D33 Q96 Q119 M120 M123 F178 W193 A194 F307 M311 R2 D3 Q66 Q89 M90 M93 F133 W148 A149 F235 M239
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0005000 vasopressin receptor activity
GO:0005515 protein binding
GO:0038023 signaling receptor activity
GO:0042277 peptide binding
Biological Process
GO:0001992 regulation of systemic arterial blood pressure by vasopressin
GO:0003084 positive regulation of systemic arterial blood pressure
GO:0003092 renal water retention
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007190 activation of adenylate cyclase activity
GO:0007599 hemostasis
GO:0008284 positive regulation of cell population proliferation
GO:0008285 negative regulation of cell population proliferation
GO:0010628 positive regulation of gene expression
GO:0021537 telencephalon development
GO:0032870 cellular response to hormone stimulus
GO:0034097 response to cytokine
GO:0035811 negative regulation of urine volume
GO:0045777 positive regulation of blood pressure
GO:0045907 positive regulation of vasoconstriction
GO:1902533 positive regulation of intracellular signal transduction
Cellular Component
GO:0005768 endosome
GO:0005783 endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030139 endocytic vesicle
GO:0030669 clathrin-coated endocytic vesicle membrane
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7bb7, PDBe:7bb7, PDBj:7bb7
PDBsum7bb7
PubMed34020960
UniProtP30518|V2R_HUMAN Vasopressin V2 receptor (Gene Name=AVPR2)

[Back to BioLiP]