Structure of PDB 7b4d Chain A

Receptor sequence
>7b4dA (length=197) Species: 9606 (Homo sapiens) [Search protein sequence]
SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPV
QLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCDGLAPPQHLIR
VEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNRSCMGGM
NRRPILTIITLEDSSGNLLGRNSFEVCVCACPGRDRRTEEENLRKKG
3D structure
PDB7b4d Structural basis of reactivation of oncogenic p53 mutants by a small molecule: methylene quinuclidinone (MQ).
ChainA
Resolution1.85 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R240 S241 A276 C277 R280 R144 S145 A180 C181 R184
BS02 ZN A C176 H179 C238 C242 C83 H86 C142 C146
BS03 QNN A L114 C124 L21 C31
BS04 QN8 A Q144 W146 S227 C229 Q51 W53 S131 C133
BS05 QNN A Q144 C229 Q51 C133
BS06 QNN A A276 C277 A180 C181
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006915 apoptotic process
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7b4d, PDBe:7b4d, PDBj:7b4d
PDBsum7b4d
PubMed34862374
UniProtP04637|P53_HUMAN Cellular tumor antigen p53 (Gene Name=TP53)

[Back to BioLiP]