Structure of PDB 7b20 Chain A

Receptor sequence
>7b20A (length=138) Species: 405948 (Saccharopolyspora erythraea NRRL 2338) [Search protein sequence]
DLIDTTEMYLRTIYDLEEEGVVPLRARIAERLEQSGPTVSQTVARMERDG
LLTVAEDRHLELTKAGRARAISVMRKHRLAERLLVDVIGLEWEQVHLEAC
RWEHVMSEAVERKLVKLLGNPTTSPYGNPIPGLDELGV
3D structure
PDB7b20 The bacterial iron sensor IdeR recognizes its DNA targets by indirect readout.
ChainA
Resolution2.18 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 dna A R27 A28 R29 P39 S42 R60 R25 A26 R27 P37 S40 R58
BS02 dna A T7 Q36 S37 P39 T40 Q43 R47 R50 T5 Q34 S35 P37 T38 Q41 R45 R48
BS03 FE2 A H79 E83 H98 H77 E81 H96
BS04 FE2 A M10 C102 E105 H106 M8 C100 E103 H104
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sun Dec 1 18:42:48 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7b20', asym_id = 'A', title = 'The bacterial iron sensor IdeR recognizes its DNA targets by indirect readout.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7b20', asym_id='A', title='The bacterial iron sensor IdeR recognizes its DNA targets by indirect readout.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003677,0003700,0006355,0046914,0046983', uniprot = '', pdbid = '7b20', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0003700,0006355,0046914,0046983', uniprot='', pdbid='7b20', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>