Structure of PDB 7b1l Chain A

Receptor sequence
>7b1lA (length=200) Species: 243232 (Methanocaldococcus jannaschii DSM 2661) [Search protein sequence]
MFSIRKIITISDYVTMLNIITGLLAILLNSFSLIYLSIIFDSLDGYVARK
TGTVSDFGAELDSISDVVSFGVAPAYLLYNNFESNLALISAIIFCLCGAL
RLARFGILNVKGFIGLPIPAGALLLVGFCQLINSYLINSILAILIGLLMI
SDIKYPKYPNKIFIYIFAVSLCLAIVGIPHFALMLCLIYAIYGIIKYIRG
3D structure
PDB7b1l Crystal structures of phosphatidyl serine synthase PSS reveal the catalytic mechanism of CDP-DAG alcohol O-phosphatidyl transferases
ChainA
Resolution1.85 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.8.8: CDP-diacylglycerol--serine O-phosphatidyltransferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 58A A S11 D12 T15 D41 S42 D44 G45 A48 R49 V54 G58 D62 F167 A168 L185 Y189 S11 D12 T15 D41 S42 D44 G45 A48 R49 V54 G58 D62 F167 A168 L185 Y189
BS02 CA A D41 D44 D62 D41 D44 D62
BS03 SER A A59 D62 S63 F105 A59 D62 S63 F105
BS04 SER A S42 Y46 R49 S42 Y46 R49
BS05 MG A D41 D62 D66 D41 D62 D66
Gene Ontology
Molecular Function
GO:0003882 CDP-diacylglycerol-serine O-phosphatidyltransferase activity
GO:0016740 transferase activity
GO:0016780 phosphotransferase activity, for other substituted phosphate groups
Biological Process
GO:0008654 phospholipid biosynthetic process
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7b1l, PDBe:7b1l, PDBj:7b1l
PDBsum7b1l
PubMed
UniProtQ58609|PSS_METJA CDP-diacylglycerol--serine O-phosphatidyltransferase (Gene Name=pssA)

[Back to BioLiP]