Structure of PDB 7auq Chain A

Receptor sequence

>7auqA (length=142) Species: 559292 (Saccharomyces cerevisiae S288C)

ENQVYSPVTGARLVAGCICLTPDKKQVLMITSSAHKKRWIVPKGGVEKDE
PNYETTAQRETWEEAGCIGKIVANLGTVEDMRPPRTEFHFYELEIENLLD
KFPECHKRHRKLYSYTEAKQNLIDAKRPELLEALNRSAIIKD

3D structure

• PDB: 7auq Multiple substrate recognition by yeast diadenosine and diphosphoinositol polyphosphate phosphohydrolase through phosphate clamping.
• Chain: A
• Resolution: 2.25 Å

Enzymatic activity

• Enzyme Commision number: 3.6.1.10: endopolyphosphatase.
  3.6.1.52: diphosphoinositol-polyphosphate diphosphatase.
  3.6.1.60: diadenosine hexaphosphate hydrolase (AMP-forming).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	5FA	A	R32 S52 S53 K63 G65 D100 R152 R171 E173	R12 S32 S33 K43 G45 D80 R108 R127 E129
BS02	CA	A	K63 E84	K43 E64

Gene Ontology

Molecular Function

• GO:0000298 endopolyphosphatase activity
• GO:0008486 diphosphoinositol-polyphosphate diphosphatase activity
• GO:0016462 pyrophosphatase activity
• GO:0016787 hydrolase activity
• GO:0034431 bis(5'-adenosyl)-hexaphosphatase activity
• GO:0034432 bis(5'-adenosyl)-pentaphosphatase activity
• GO:0046872 metal ion binding
• GO:1990174 phosphodiesterase decapping endonuclease activity

Biological Process

• GO:0006798 polyphosphate catabolic process
• GO:0015961 diadenosine polyphosphate catabolic process
• GO:0071543 diphosphoinositol polyphosphate metabolic process
• GO:1901907 diadenosine pentaphosphate catabolic process
• GO:1901909 diadenosine hexaphosphate catabolic process
• GO:1901911 adenosine 5'-(hexahydrogen pentaphosphate) catabolic process

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:7auq, PDBe:7auq, PDBj:7auq
• PDBsum: 7auq
• PubMed: 33893105
• UniProt: Q99321|DDP1_YEAST Diphosphoinositol polyphosphate phosphohydrolase DDP1 (Gene Name=DDP1)