Structure of PDB 7aup Chain A

Receptor sequence

>7aupA (length=160) Species: 559292 (Saccharomyces cerevisiae S288C)

RENQVYSPVTGARLVAGCICLTPDKKQVLMITSSAHKKRWIVPKGGVEKD
EPNYETTAQRETWEEAGCIGKIVANLGTVEDMRPPQFENSRKDSEVAKHP
PRTEFHFYELEIENLLDKFPECHKRHRKLYSYTEAKQNLIDAKRPELLEA
LNRSAIIKDD

3D structure

• PDB: 7aup Multiple substrate recognition by yeast diadenosine and diphosphoinositol polyphosphate phosphohydrolase through phosphate clamping.
• Chain: A
• Resolution: 1.85 Å

Enzymatic activity

• Enzyme Commision number: 3.6.1.10: endopolyphosphatase.
  3.6.1.52: diphosphoinositol-polyphosphate diphosphatase.
  3.6.1.60: diadenosine hexaphosphate hydrolase (AMP-forming).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	VEB	A	R32 S52 S53 H55 K63 R102 R129 R152 R171	R13 S33 S34 H36 K44 R83 R102 R125 R144
BS02	MG	A	K63 E84	K44 E65

Gene Ontology

Molecular Function

• GO:0000298 endopolyphosphatase activity
• GO:0008486 diphosphoinositol-polyphosphate diphosphatase activity
• GO:0016462 pyrophosphatase activity
• GO:0016787 hydrolase activity
• GO:0034431 bis(5'-adenosyl)-hexaphosphatase activity
• GO:0034432 bis(5'-adenosyl)-pentaphosphatase activity
• GO:0046872 metal ion binding
• GO:1990174 phosphodiesterase decapping endonuclease activity

Biological Process

• GO:0006798 polyphosphate catabolic process
• GO:0015961 diadenosine polyphosphate catabolic process
• GO:0071543 diphosphoinositol polyphosphate metabolic process
• GO:1901907 diadenosine pentaphosphate catabolic process
• GO:1901909 diadenosine hexaphosphate catabolic process
• GO:1901911 adenosine 5'-(hexahydrogen pentaphosphate) catabolic process

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:7aup, PDBe:7aup, PDBj:7aup
• PDBsum: 7aup
• PubMed: 33893105
• UniProt: Q99321|DDP1_YEAST Diphosphoinositol polyphosphate phosphohydrolase DDP1 (Gene Name=DDP1)